PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG016772.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family VOZ
Protein Properties Length: 489aa    MW: 54831.5 Da    PI: 5.9325
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG016772.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ426.54.2e-1312074241217
          VOZ   1 pppsaflgpkcalwdctrpaqg.sewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelfd 97 
                  pppsaflgpkcalwdc+rpaqg  +w+qdycssfh ++a+neg+pg++p+lrp+gi+lkd llf++l+akv+gk+vgipecegaatakspwna+elfd
  CCG016772.1 207 PPPSAFLGPKCALWDCPRPAQGgLDWYQDYCSSFHHDVAVNEGPPGLSPILRPGGIGLKDCLLFSSLRAKVEGKDVGIPECEGAATAKSPWNAPELFD 304
                  89******************9648************************************************************************** PP

          VOZ  98 lsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdekks 195
                  ls+l+getirewlffdkprrafesgnrkqrslpdy+grgwhesrkqvm+e+gglkrsyymdpqp+++fewhlyeyein++da+alyrlelk vd+kks
  CCG016772.1 305 LSVLKGETIREWLFFDKPRRAFESGNRKQRSLPDYTGRGWHESRKQVMNEYGGLKRSYYMDPQPLNNFEWHLYEYEINNCDACALYRLELKAVDGKKS 402
                  ************************************************************************************************** PP

          VOZ 196 akgkvskdsladlqkklgrlta 217
                  akgk++++s++dlqk++grlta
  CCG016772.1 403 AKGKLANESVVDLQKQMGRLTA 424
                  ********************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 489 aa     Download sequence    Send to blast
MGKGSKINCK SASHKLFKDK AKNRVDDLQG MFLDLQFARK ESRTVDVAVL EEQVHQMLRE  60
WKAELNEPSP ASSLQQGGSL GSFSTDICRL LQLCEEEDDA TSALAAPKPE PNDQSLQVGN  120
NVIFQEGYGV NHDQQEHVFP FVDECKDSPS GVRSMVINNM EGLAQLEYHH FDLPQNSEQN  180
FYTGFNGMDL SEDATHLVSS YLPSMCPPPS AFLGPKCALW DCPRPAQGGL DWYQDYCSSF  240
HHDVAVNEGP PGLSPILRPG GIGLKDCLLF SSLRAKVEGK DVGIPECEGA ATAKSPWNAP  300
ELFDLSVLKG ETIREWLFFD KPRRAFESGN RKQRSLPDYT GRGWHESRKQ VMNEYGGLKR  360
SYYMDPQPLN NFEWHLYEYE INNCDACALY RLELKAVDGK KSAKGKLANE SVVDLQKQMG  420
RLTAEFPSDH KRTVKGRTKV NAKAGVRNVY SGSTRVAPTN EAYDYGPGPH YDYLVENLGD  480
YYLTQFKKP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011001208.10.0PREDICTED: transcription factor VOZ1-like isoform X1
RefseqXP_011001207.10.0PREDICTED: transcription factor VOZ1-like isoform X1
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLB9N9L20.0B9N9L2_POPTR; Uncharacterized protein
STRINGPOPTR_0011s05890.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14983494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein